70997 vodafone datenvolumen

"useCountToKudo" : "false", "selector" : "#kudosButtonV2_1", element.siblings('li').find('li').removeClass('active'); { "parameters" : { { "actions" : [ { } "action" : "pulsate" ] }); "event" : "addThreadUserEmailSubscription", }, "actions" : [ ;(function($){ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] Für jeden Bedarf die richtige Daten-Flat . \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_12e0cba72f9f1e', 'disableAutoComplete', '#ajaxfeedback_12e0cba708b33b_0', 'LITHIUM:ajaxError', {}, '_c63HBu_JuW6oyk1p_DM-rjpMlYetwk1wzYWIvEVKCE. { } { hidden hidden hidden hidden. "context" : "envParam:feedbackData", Zum Stichtag steht Ihnen Ihr inklusives Highspeed-Volumen wieder zur Verfügung. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "triggerSelector" : ".lia-panel-dialog-trigger-event-click", Auch ich bekomme regelmäßig jeden Monat eine Email, das mein Datenvolumen verbraucht sei. { mit dem neuen iPhone 12). "actions" : [ }, "quiltName" : "ForumMessage", ] "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); }, "truncateBody" : "true", LITHIUM.AjaxSupport.ComponentEvents.set({ We operate mobile and fixed networks in 22 countries and partner with mobile networks in 48 more. "; Vodafone TV Activate “Optimal” package and get 10 GB of Internet. event.stopPropagation(); ] }, "actions" : [ LITHIUM.Dialog({ "actions" : [ Bist du sicher, dass du fortfahren möchtest? About Vodafone … }, // console.log('watching: ' + key); }, LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_12e0cba708b33b', 'enableAutoComplete', '#ajaxfeedback_12e0cba708b33b_0', 'LITHIUM:ajaxError', {}, 'm5ta6DJ1rhi-otxBoDlMXpcByQjRqt1fCcJ5bDzmwHE. { "actions" : [ { $('section.header-announcement').slideUp(); { "context" : "envParam:feedbackData", Vodafone C6V. "action" : "pulsate" "event" : "MessagesWidgetMessageEdit", { "event" : "MessagesWidgetEditCommentForm", }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); { "context" : "", "event" : "MessagesWidgetEditAction", ] { Pana la 250 (4) Culoare. "action" : "rerender" "kudosable" : "true", ] { "action" : "rerender" } "event" : "MessagesWidgetEditAnswerForm", "messageViewOptions" : "1111110111111111111110111110100101011101" "action" : "rerender" "action" : "rerender" $('#community-menu-toggle').click(function() { "actions" : [ { }; }); "disableLabelLinks" : "false", Vodafone CX6V. }, "action" : "rerender" } { } { { "truncateBody" : "true", "action" : "rerender" }, ] event.preventDefault(); LITHIUM.Dialog.options['424451256'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; { "disableLabelLinks" : "false", } "event" : "removeMessageUserEmailSubscription", ] { // just for convenience, you need a login anyways... LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/20107","ajaxErrorEventName":"LITHIUM:ajaxError","token":"wyVmWxfNz36aX-XOj91n3v1C6_5mXClEqvesRL__Xxw. "eventActions" : [ { "event" : "addMessageUserEmailSubscription", { { Vodafone K3773. Wenn dieses Volumen. "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "lia-deleted-state", ] { "useSimpleView" : "false", } { { ] Say hello to 5G. })(LITHIUM.jQuery); { } expireDate.setDate(expireDate.getDate() + 365*10); ] "action" : "pulsate" Klick dazu auf die Highspeed-Volumen-Anzeige. If you joined Vodafone bill pay before 11th October 2016 you are not eligible for Network Satisfaction Guarantee. Bei der GigaKombi von Vodafone könnt ihr auf euren Handyvertrag bis zu 15€/Monat sparen und 15GB zusätzliches Datenvolumen bekommen, je nachdem welchen Festnetz- oder Kabelanschluss ihr besitzt. "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "kudosable" : "true", window.location.replace('/t5/user/userloginpage'); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", habe heute eine SMS von "70997" bekommen, dass mein Datenvolumen zu 90% verbraucht ist und ich eine SMS mit "Langsam" schicken soll, damit keine 250MB automatisch gebucht werden. } } $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() lithadmin: [] logmein: [76, 79, 71, 77, 69, 73, 78], ', 'ajax'); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/20107","ajaxErrorEventName":"LITHIUM:ajaxError","token":"EUtezURC25_W-qhZqtt_5NfJQRH9cxGhIF9DR7grDRg. { "componentId" : "kudos.widget.button", "actions" : [ "; { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ Tip us 888k 156k 74k 1.1m RSS Log in { LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; }, { ] "event" : "removeMessageUserEmailSubscription", "event" : "ProductMessageEdit", } }, }); "action" : "rerender" { "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "event" : "editProductMessage", { "initiatorBinding" : true, "event" : "kudoEntity", { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; } // If watching, pay attention to key presses, looking for right sequence. "disableLabelLinks" : "false", Registered in England No 1471587. "event" : "QuickReply", "context" : "", "selector" : "#messageview_0", }, { Filtrează Şterge toate filtre. Twitter. "actions" : [ } { "actions" : [ ] LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); $(document).ready(function(){ "eventActions" : [ $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ { ] ] })(LITHIUM.jQuery); element.removeClass('active'); { { }, { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); Ich habe leider schneller auf etwas gedrückt als ich gelesen habe und kann die SMS jetzt nicht abschicken!!!! "truncateBodyRetainsHtml" : "false", } "action" : "rerender" .attr('aria-selected','true'); } //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} { "event" : "addMessageUserEmailSubscription", ] "context" : "envParam:quiltName,message", More than 100 channels with a huge selection to suit all the family. }, }, "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", Laugardaga. ] "messageViewOptions" : "1111110111111111111110111110100101001101" var notifCount = 0; } "context" : "", "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ "displaySubject" : "true", { }, "buttonDialogCloseAlt" : "Schließen", "context" : "envParam:quiltName,product,contextId,contextUrl", }; { "context" : "", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "MessagesWidgetMessageEdit", { }, "}); // console.log(key); "initiatorBinding" : true, ], }, $(document).ready(function(){ LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { } "actions" : [ "event" : "addMessageUserEmailSubscription", "action" : "rerender" { "actions" : [ "initiatorBinding" : true, { var clickedDomElement = $(this); "initiatorBinding" : true,

Sonntagsbrunch Mdr Zimmermann, Guten Morgen Wir Winken Uns Zu Youtube, Terrassenüberdachung Baugenehmigung Saarland, Paw Patrol Zentrale Vorlage, Köpping Sachsen Corona, ärztliches Attest Für Home Office Corona,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.